PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla003370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family WRKY
Protein Properties Length: 121aa    MW: 14204 Da    PI: 9.9321
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla003370genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.88.3e-324199159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
               ldDgy+WrKYGqK vk+ +fprsYY+C+++gC+vkk+++r ++d+ vv +tYeg H h+
  Cla003370 41 LDDGYRWRKYGQKAVKNDKFPRSYYKCSHQGCKVKKQIQRLTNDEGVVLTTYEGVHSHP 99
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-332699IPR003657WRKY domain
SuperFamilySSF1182907.32E-2934100IPR003657WRKY domain
PROSITE profilePS5081128.73636101IPR003657WRKY domain
SMARTSM007743.6E-3541100IPR003657WRKY domain
PfamPF031061.1E-254299IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MDHQFQEESS VKKTSSGSMK SEKKIRKGRF AFETRSQVDV LDDGYRWRKY GQKAVKNDKF  60
PRSYYKCSHQ GCKVKKQIQR LTNDEGVVLT TYEGVHSHPI ETPQDNFQHI LTHMQIYPSS  120
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2728100476Probable WRKY transcription factor 4
2lex_A7e-2728100476Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818154e-37LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBankLN7132574e-37LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138624.22e-59PREDICTED: probable WRKY transcription factor 45
RefseqXP_012085719.12e-59PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA22e-51WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A0A0LT012e-59A0A0A0LT01_CUCSA; Uncharacterized protein
TrEMBLS5CKE72e-59S5CKE7_JATCU; Uncharacterized protein
STRINGSi026859m5e-56(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-52WRKY DNA-binding protein 75